PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 923aa    MW: 102405 Da    PI: 5.4814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607460.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-182874148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_013607460.1 28 KGQWTPEEDEVLCKAVERFQGKNWKKIAECVK-DRTDVQCLHRWQKVL 74
                     799****************************9.************986 PP

2Myb_DNA-binding59.48e-1980126148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd  ++ +v+++G+  W+tI+++++ gR +kqc++rw+++l
   XP_013607460.1  80 KGPWSKEEDNTIIALVEKYGPTKWSTISQHLP-GRIGKQCRERWHNHL 126
                      79******************************.*************97 PP

3Myb_DNA-binding51.81.9e-16132174145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+  ++ ++ gR+++ +k++w+
   XP_013607460.1 132 KNAWTQEEELTLIRAHQIYGNK-WAELMKFLP-GRSDNAIKNHWN 174
                      689*******************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0712374IPR017930Myb domain
SuperFamilySSF466891.65E-182688IPR009057Homeodomain-like
SMARTSM007171.2E-142776IPR001005SANT/Myb domain
PfamPF002492.9E-152874IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-222986IPR009057Homeodomain-like
CDDcd001671.92E-133174No hitNo description
PROSITE profilePS5129432.12575130IPR017930Myb domain
SuperFamilySSF466898.99E-3177173IPR009057Homeodomain-like
SMARTSM007176.9E-1879128IPR001005SANT/Myb domain
PfamPF002499.5E-1880126IPR001005SANT/Myb domain
CDDcd001671.47E-1582126No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2687134IPR009057Homeodomain-like
PROSITE profilePS5129418.455131181IPR017930Myb domain
SMARTSM007171.9E-14131179IPR001005SANT/Myb domain
PfamPF002492.7E-14132175IPR001005SANT/Myb domain
CDDcd001675.16E-11134174No hitNo description
Gene3DG3DSA:1.10.10.603.8E-21135181IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    Send to blast
MKPEMKAPNV TEGVKHGRTC GPTRRSTKGQ WTPEEDEVLC KAVERFQGKN WKKIAECVKD  60
RTDVQCLHRW QKVLNPELVK GPWSKEEDNT IIALVEKYGP TKWSTISQHL PGRIGKQCRE  120
RWHNHLNPGI NKNAWTQEEE LTLIRAHQIY GNKWAELMKF LPGRSDNAIK NHWNSAVKKK  180
LDSYYASGLL DQSQSSPLIA LQNRSIASSS SLMHSSGDES NFRQGADAEE SECSQASTVF  240
SCSQSNNDLL DEVKPPNEEE FYIPELLSGL EQQVSNSPSH AESYCPSFED VKIVVPEVRT  300
TTATENHLQG VSNNVRQDLD LDCPQLLTNN MDGDENNEAC QAIQDSVRLS YQPSLPNLDT  360
SLHPQPQTLT TDVECCRVLF PYAMKDNGTS SVEQGQNMVD PPKGKGEETH AHETGNIPAL  420
SWHQSNSESL EGHNGVTLLY SAVEDSVLLH NDSTQGCHLL GATALERETD TNDGHLASHG  480
NDDNDGIPES YITNDSLKLV PLNNFASPSR VNKIHFPIDE KQAEKDKGSL CYEPPRFPSA  540
DIPFFSCDLV PSNSDLRQEY SPFGIRQLMN CTTPLRLWDS PCRHDKSPDV KSFSGAPSIL  600
RKRRGDLLLS PMLDRRKEKM VKSAKASSLA LDFSRLDDCN KNKRASSSEA KEDPKETLES  660
GGVSSAKIDQ ETRRSLVYYN DVGMQVSSPD KAGSRLDNKV NTVAKDPSDQ HERSLANIPT  720
GEISSEPPFT ADEIPLSVIS GIKTNTAESS VDIESFSIFD GTPFKKLLDT PSPWKSAPWK  780
SPLLFGSFLQ SQNLDPDITL EDIGCFMSPG ERSYDAIGLM KHLSEHTATA YADALEVLGN  840
DTPETILKKR RLNKSIQGKE NQHWPQDQLE NRSQVEGRAL DFSNCGTPGK AKVSSASPGS  900
YSSPSSYLLK SCRSFNSGHK TID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-66281816159MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-66281816159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1516460.0AF151646.1 Arabidopsis thaliana PC-MYB1 (PC-MYB1) mRNA, complete cds.
GenBankAF1760050.0AF176005.2 Arabidopsis thaliana putative c-myb-like transcription factor (AtMYB3R-1) mRNA, complete cds.
GenBankAF1897840.0AF189784.1 Arabidopsis thaliana putative c-myb-like transcription factor (MYB3R-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607402.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_013607460.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_013670664.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D3A2H90.0A0A0D3A2H9_BRAOL; Uncharacterized protein
STRINGBra011376.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein